Lineage for d2ivib1 (2ivi B:3-331)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677672Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 677673Family b.82.2.1: Penicillin synthase-like [51198] (4 proteins)
    common fold is rather distorted
  6. 677702Protein Isopenicillin N synthase [51199] (1 species)
  7. 677703Species Emericella nidulans [TaxId:162425] [51200] (25 PDB entries)
  8. 677705Domain d2ivib1: 2ivi B:3-331 [137723]
    automatically matched to d1bk0__
    complexed with acw, fe2, so4

Details for d2ivib1

PDB Entry: 2ivi (more details), 1.3 Å

PDB Description: Isopenicillin N Synthase From Aspergillus Nidulans (Anaerobic Ac- methyl-cyclopropylglycine Fe Complex)
PDB Compounds: (B:) isopenicillin n synthetase

SCOP Domain Sequences for d2ivib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivib1 b.82.2.1 (B:3-331) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

SCOP Domain Coordinates for d2ivib1:

Click to download the PDB-style file with coordinates for d2ivib1.
(The format of our PDB-style files is described here.)

Timeline for d2ivib1: