Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily) beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet |
Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) |
Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins) |
Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55716] (4 PDB entries) |
Domain d2iv9b2: 2iv9 B:825-937 [137722] Other proteins in same PDB: d2iv9a1, d2iv9b1 automatically matched to d1e42a2 complexed with so4 |
PDB Entry: 2iv9 (more details), 1.9 Å
SCOPe Domain Sequences for d2iv9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iv9b2 d.105.1.1 (B:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
Timeline for d2iv9b2: