![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains |
![]() | Protein Beta2-adaptin AP2 ear domain, N-terminal subdomain [49352] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49353] (4 PDB entries) |
![]() | Domain d2iv9b1: 2iv9 B:705-824 [137721] Other proteins in same PDB: d2iv9a2, d2iv9b2 automatically matched to d1e42a1 complexed with so4 |
PDB Entry: 2iv9 (more details), 1.9 Å
SCOP Domain Sequences for d2iv9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iv9b1 b.1.10.1 (B:705-824) Beta2-adaptin AP2 ear domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
Timeline for d2iv9b1: