SCOPe 2.08: Domain d2iv9a2: 2iv9 A:825-937

Lineage for d2iv9a2 (2iv9 A:825-937)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
   beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet

4. Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families)

5. Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)

6. Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55716] (4 PDB entries)

8. Domain d2iv9a2: 2iv9 A:825-937 [137720]
   Other proteins in same PDB: d2iv9a1, d2iv9b1
   automatically matched to d1e42a2
   complexed with so4

Details for d2iv9a2

PDB Entry: 2iv9, 1.9 Å

PDB Description: b2-appendage from ap2 in complex with eps15 peptide

PDB Compounds: (A:) ap-2 complex subunit beta-2

SCOPe Domain Sequences for d2iv9a2:

Sequence; same for both SEQRES and ATOM records:

>d2iv9a2 d.105.1.1 (A:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn

Timeline for d2iv9a2:

• d2iv9a2 first appeared in SCOP 1.73
  
• d2iv9a2 appears in SCOPe 2.07