Lineage for d2iv9a2 (2iv9 A:825-937)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533059Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 2533060Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 2533061Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 2533074Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species)
  7. 2533075Species Human (Homo sapiens) [TaxId:9606] [55716] (4 PDB entries)
  8. 2533079Domain d2iv9a2: 2iv9 A:825-937 [137720]
    Other proteins in same PDB: d2iv9a1, d2iv9b1
    automatically matched to d1e42a2
    complexed with so4

Details for d2iv9a2

PDB Entry: 2iv9 (more details), 1.9 Å

PDB Description: b2-appendage from ap2 in complex with eps15 peptide
PDB Compounds: (A:) ap-2 complex subunit beta-2

SCOPe Domain Sequences for d2iv9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iv9a2 d.105.1.1 (A:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn

SCOPe Domain Coordinates for d2iv9a2:

Click to download the PDB-style file with coordinates for d2iv9a2.
(The format of our PDB-style files is described here.)

Timeline for d2iv9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iv9a1