Lineage for d2iv8a1 (2iv8 A:705-824)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769708Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 1769709Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 protein domains)
    ear domain consists of two different subdomains
    automatically mapped to Pfam PF02883
  6. 1769722Protein Beta2-adaptin AP2 ear domain, N-terminal subdomain [49352] (1 species)
  7. 1769723Species Human (Homo sapiens) [TaxId:9606] [49353] (4 PDB entries)
  8. 1769729Domain d2iv8a1: 2iv8 A:705-824 [137717]
    Other proteins in same PDB: d2iv8a2
    automatically matched to d1e42a1

Details for d2iv8a1

PDB Entry: 2iv8 (more details), 2.8 Å

PDB Description: beta appendage in complex with b-arrestin peptide
PDB Compounds: (A:) AP-2 complex subunit beta-1

SCOPe Domain Sequences for d2iv8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iv8a1 b.1.10.1 (A:705-824) Beta2-adaptin AP2 ear domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv

SCOPe Domain Coordinates for d2iv8a1:

Click to download the PDB-style file with coordinates for d2iv8a1.
(The format of our PDB-style files is described here.)

Timeline for d2iv8a1: