![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains automatically mapped to Pfam PF02883 |
![]() | Protein Beta2-adaptin AP2 ear domain, N-terminal subdomain [49352] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49353] (4 PDB entries) |
![]() | Domain d2iv8a1: 2iv8 A:705-824 [137717] Other proteins in same PDB: d2iv8a2 automatically matched to d1e42a1 |
PDB Entry: 2iv8 (more details), 2.8 Å
SCOPe Domain Sequences for d2iv8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iv8a1 b.1.10.1 (A:705-824) Beta2-adaptin AP2 ear domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
Timeline for d2iv8a1: