Lineage for d2iv7a1 (2iv7 A:2-371)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910940Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
    Pfam PF00534
  6. 2910953Protein Lipopolysaccharide core biosynthesis protein RfaG [142771] (1 species)
    Glucosyltransferase I
  7. 2910954Species Escherichia coli [TaxId:562] [142772] (2 PDB entries)
    Uniprot P25740 2-371
  8. 2910956Domain d2iv7a1: 2iv7 A:2-371 [137716]
    complexed with udp

Details for d2iv7a1

PDB Entry: 2iv7 (more details), 1.6 Å

PDB Description: crystal structure of waag, a glycosyltransferase involved in lipopolysaccharide biosynthesis
PDB Compounds: (A:) lipopolysaccharide core biosynthesis protein rfag

SCOPe Domain Sequences for d2iv7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iv7a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]}
ivafclykyfpfgglqrdfmriastvaarghhvrvytqswegdcpkafeliqvpvkshtn
hgrnaeyyawvqnhlkehpadrvvgfnkmpgldvyfaadvcyaekvaqekgflyrltsry
rhyaaferatfeqgkstklmmltdkqiadfqkhyqteperfqilppgiypdrkyseqipn
sreiyrqkngikeqqnlllqvgsdfgrkgvdrsiealaslpeslrhntllfvvgqdkprk
fealaeklgvrsnvhffsgrndvselmaaadlllhpayqeaagivlleaitaglpvltta
vcgyahyiadancgtviaepfsqeqlnevlrkaltqsplrmawaenarhyadtqdlyslp
ekaadiitgg

SCOPe Domain Coordinates for d2iv7a1:

Click to download the PDB-style file with coordinates for d2iv7a1.
(The format of our PDB-style files is described here.)

Timeline for d2iv7a1: