Lineage for d2iv2x2 (2iv2 X:1-564)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140562Protein Formate dehydrogenase H [53711] (1 species)
  7. 2140563Species Escherichia coli [TaxId:562] [53712] (4 PDB entries)
  8. 2140564Domain d2iv2x2: 2iv2 X:1-564 [137715]
    Other proteins in same PDB: d2iv2x1
    automatically matched to d1aa6_2
    complexed with 2md, mgd, mo, sf4, unx

Details for d2iv2x2

PDB Entry: 2iv2 (more details), 2.27 Å

PDB Description: Reinterpretation of reduced form of formate dehydrogenase H from E. coli
PDB Compounds: (X:) formate dehydrogenase h

SCOPe Domain Sequences for d2iv2x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iv2x2 c.81.1.1 (X:1-564) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
mkkvvtvcpycasgckinlvvdngkivraeaaqgktnqgtlclkgyygwdfindtqiltp
rlktpmirrqrggklepvswdealnyvaerlsaikekygpdaiqttgssrgtgnetnyvm
qkfaravigtnnvdccarvahgpsvaglhqsvgngamsnaineidntdlvfvfgynpads
hpivanhvinakrngakiivcdprkietariadmhialkngsniallnamghviieenly
dkafvasrtegfeeyrkivegytpesveditgvsaseirqaarmyaqaksaailwgmgvt
qfyqgvetvrsltslamltgnlgkphagvnpvrgqnnvqgacdmgalpdtypgyqyvkdp
anrekfakawgveslpahtgyriselphraahgevraayimgedplqtdaelsavrkafe
dlelvivqdifmtktasaadvilpstswgehegvftaadrgfqrffkavepkwdlktdwq
iiseiatrmgypmhynntqeiwdelrhlcpdfygatyekmgelgfiqwpcrdtsdadqgt
sylfkekfdtpnglaqfftcdwva

SCOPe Domain Coordinates for d2iv2x2:

Click to download the PDB-style file with coordinates for d2iv2x2.
(The format of our PDB-style files is described here.)

Timeline for d2iv2x2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iv2x1