Lineage for d2iv2x1 (2iv2 X:565-715)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070519Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2070582Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2070613Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2070640Protein Formate dehydrogenase H [50700] (1 species)
  7. 2070641Species Escherichia coli [TaxId:562] [50701] (4 PDB entries)
  8. 2070642Domain d2iv2x1: 2iv2 X:565-715 [137714]
    Other proteins in same PDB: d2iv2x2
    automatically matched to d1aa6_1
    complexed with 2md, mgd, mo, sf4, unx

Details for d2iv2x1

PDB Entry: 2iv2 (more details), 2.27 Å

PDB Description: reinterpretation of reduced form of formate dehydrogenase h from e. coli
PDB Compounds: (X:) formate dehydrogenase h

SCOPe Domain Sequences for d2iv2x1:

Sequence, based on SEQRES records: (download)

>d2iv2x1 b.52.2.2 (X:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

Sequence, based on observed residues (ATOM records): (download)

>d2iv2x1 b.52.2.2 (X:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwpeykycavrvepiadqraaeqyvidey
nklktrlreaala

SCOPe Domain Coordinates for d2iv2x1:

Click to download the PDB-style file with coordinates for d2iv2x1.
(The format of our PDB-style files is described here.)

Timeline for d2iv2x1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iv2x2