SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2iv2x1 (2iv2 X:565-715)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061195Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2061226Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 protein domains)
    molybdopterine enzyme
  6. 2061253Protein Formate dehydrogenase H [50700] (1 species)
  7. 2061254Species Escherichia coli [TaxId:562] [50701] (4 PDB entries)
  8. 2061255Domain d2iv2x1: 2iv2 X:565-715 [137714]
    Other proteins in same PDB: d2iv2x2
    automatically matched to d1aa6_1
    complexed with 2md, mgd, mo, sf4, unx

Details for d2iv2x1

PDB Entry: 2iv2 (more details), 2.27 Å

PDB Description: Reinterpretation of reduced form of formate dehydrogenase H from E. coli
PDB Compounds: (X:) formate dehydrogenase h

SCOPe Domain Sequences for d2iv2x1:

Sequence, based on SEQRES records: (download)

>d2iv2x1 b.52.2.2 (X:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

Sequence, based on observed residues (ATOM records): (download)

>d2iv2x1 b.52.2.2 (X:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwpeykycavrvepiadqraaeqyvidey
nklktrlreaala

SCOPe Domain Coordinates for d2iv2x1:

Click to download the PDB-style file with coordinates for d2iv2x1.
(The format of our PDB-style files is described here.)

Timeline for d2iv2x1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iv2x2