![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
![]() | Family c.1.8.5: Type II chitinase [51534] (14 proteins) glycosylase family 18 |
![]() | Protein Chitinase 1 [51548] (2 species) |
![]() | Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries) Uniprot Q873X9 |
![]() | Domain d2iuza1: 2iuz A:39-298,A:361-433 [137710] Other proteins in same PDB: d2iuza2, d2iuzb2 automatically matched to 1W9V A:39-298,A:361-433 complexed with d1h, so4 |
PDB Entry: 2iuz (more details), 1.95 Å
SCOP Domain Sequences for d2iuza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iuza1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt vvnalggtgvfeqsqneldypvsqydnlrngmqt
Timeline for d2iuza1: