SCOP 1.73: Domain d2iuwa1: 2iuw A:70-279

Lineage for d2iuwa1 (2iuw A:70-279)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (2 proteins)

6. Protein AlkB homolog 3 [141631] (1 species)
   Prostate cancer antigen 1, DEPC-1

7. Species Human (Homo sapiens) [TaxId:9606] [141632] (1 PDB entry)

8. Domain d2iuwa1: 2iuw A:70-279 [137709]
   complexed with akg, bme, fe, led

Details for d2iuwa1

PDB Entry: 2iuw, 1.5 Å

PDB Description: crystal structure of human abh3 in complex with iron ion and 2- oxoglutarate

PDB Compounds: (A:) alkylated repair protein alkb homolog 3

SCOP Domain Sequences for d2iuwa1:

Sequence, based on SEQRES records:

>d2iuwa1 b.82.2.10 (A:70-279) AlkB homolog 3 {Human (Homo sapiens) [TaxId: 9606]}
rvidregvyeislsptgvsrvclypgfvdvkeadwileqlcqdvpwkqrtgiredityqq
prltawygelpytysritmepnphwhpvlrtlknrieentghtfnsllcnlyrnekdsvd
whsddepslgrcpiiaslsfgatrtfemrkkpppeengdytyvervkipldhgtllimeg
atqadwqhrvpkeyhsreprvnltfrtvyp

Sequence, based on observed residues (ATOM records):

>d2iuwa1 b.82.2.10 (A:70-279) AlkB homolog 3 {Human (Homo sapiens) [TaxId: 9606]}
rvidregvyeislsptgvsrvclypgfvdvkeadwileqlcqdvpwkqrtgiredityqq
prltawygelpytysritmepnphwhpvlrtlknrieentghtfnsllcnlyrnekdsvd
whsddepslgrcpiiaslsfgatrtfemrkkppyvervkipldhgtllimegatqadwqh
rvpkeyhsreprvnltfrtvyp

Timeline for d2iuwa1:

• d2iuwa1 is new in SCOP 1.73
  
• d2iuwa1 appears in SCOP 1.75
  
• d2iuwa1 appears in the current release, SCOPe 2.08