Lineage for d2iuwa1 (2iuw A:70-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815739Family b.82.2.10: AlkB-like [141628] (3 proteins)
    automatically mapped to Pfam PF13532
  6. 2815740Protein AlkB homolog 3 [141631] (1 species)
    Prostate cancer antigen 1, DEPC-1
  7. 2815741Species Human (Homo sapiens) [TaxId:9606] [141632] (1 PDB entry)
    Uniprot Q96Q83 70-279
  8. 2815742Domain d2iuwa1: 2iuw A:70-279 [137709]
    Other proteins in same PDB: d2iuwa2
    protein/DNA complex; protein/RNA complex; complexed with akg, bme, fe

Details for d2iuwa1

PDB Entry: 2iuw (more details), 1.5 Å

PDB Description: crystal structure of human abh3 in complex with iron ion and 2- oxoglutarate
PDB Compounds: (A:) alkylated repair protein alkb homolog 3

SCOPe Domain Sequences for d2iuwa1:

Sequence, based on SEQRES records: (download)

>d2iuwa1 b.82.2.10 (A:70-279) AlkB homolog 3 {Human (Homo sapiens) [TaxId: 9606]}
rvidregvyeislsptgvsrvclypgfvdvkeadwileqlcqdvpwkqrtgiredityqq
prltawygelpytysritmepnphwhpvlrtlknrieentghtfnsllcnlyrnekdsvd
whsddepslgrcpiiaslsfgatrtfemrkkpppeengdytyvervkipldhgtllimeg
atqadwqhrvpkeyhsreprvnltfrtvyp

Sequence, based on observed residues (ATOM records): (download)

>d2iuwa1 b.82.2.10 (A:70-279) AlkB homolog 3 {Human (Homo sapiens) [TaxId: 9606]}
rvidregvyeislsptgvsrvclypgfvdvkeadwileqlcqdvpwkqrtgiredityqq
prltawygelpytysritmepnphwhpvlrtlknrieentghtfnsllcnlyrnekdsvd
whsddepslgrcpiiaslsfgatrtfemrkkppyvervkipldhgtllimegatqadwqh
rvpkeyhsreprvnltfrtvyp

SCOPe Domain Coordinates for d2iuwa1:

Click to download the PDB-style file with coordinates for d2iuwa1.
(The format of our PDB-style files is described here.)

Timeline for d2iuwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iuwa2