| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily) intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta |
Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) ![]() automatically mapped to Pfam PF02560 |
| Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins) active form is a decamer formed by five dimers |
| Protein automated matches [230795] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [230796] (6 PDB entries) |
| Domain d2iuoh2: 2iuo H:87-156 [137704] Other proteins in same PDB: d2iuoa1, d2iuob1, d2iuoc1, d2iuod1, d2iuoe1, d2iuof1, d2iuog1, d2iuoh1, d2iuoi1, d2iuoj1 automated match to d1dwka2 complexed with azi, br, cl, so4 |
PDB Entry: 2iuo (more details), 1.9 Å
SCOPe Domain Sequences for d2iuoh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iuoh2 d.72.1.1 (H:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiigainfkldvkkvadpeggeravitl
dgkylptkpf
Timeline for d2iuoh2: