Lineage for d2iuoh1 (2iuo H:1-86)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913577Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 913578Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 913734Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein)
    probably does not bind to DNA
  6. 913735Protein Cyanase N-terminal domain [47436] (1 species)
  7. 913736Species Escherichia coli [TaxId:562] [47437] (4 PDB entries)
  8. 913774Domain d2iuoh1: 2iuo H:1-86 [137703]
    Other proteins in same PDB: d2iuoa2, d2iuob2, d2iuoc2, d2iuod2, d2iuoe2, d2iuof2, d2iuog2, d2iuoh2, d2iuoi2, d2iuoj2
    automatically matched to d1dw9a1
    complexed with azi, br, cl, so4

Details for d2iuoh1

PDB Entry: 2iuo (more details), 1.9 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (H:) cyanate hydratase

SCOPe Domain Sequences for d2iuoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iuoh1 a.35.1.4 (H:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

SCOPe Domain Coordinates for d2iuoh1:

Click to download the PDB-style file with coordinates for d2iuoh1.
(The format of our PDB-style files is described here.)

Timeline for d2iuoh1: