SCOP 1.75: Domain d2iuod1: 2iuo D:1-86

Lineage for d2iuod1 (2iuo D:1-86)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein)
   probably does not bind to DNA

6. Protein Cyanase N-terminal domain [47436] (1 species)

7. Species Escherichia coli [TaxId:562] [47437] (4 PDB entries)

8. Domain d2iuod1: 2iuo D:1-86 [137695]
   Other proteins in same PDB: d2iuoa2, d2iuob2, d2iuoc2, d2iuod2, d2iuoe2, d2iuof2, d2iuog2, d2iuoh2, d2iuoi2, d2iuoj2
   automatically matched to d1dw9a1
   complexed with azi, br, cl, so4; mutant

Details for d2iuod1

PDB Entry: 2iuo, 1.9 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase

PDB Compounds: (D:) cyanate hydratase

SCOP Domain Sequences for d2iuod1:

Sequence; same for both SEQRES and ATOM records:

>d2iuod1 a.35.1.4 (D:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

Timeline for d2iuod1:

• d2iuod1 first appeared in SCOP 1.73
  
• d2iuod1 appears in SCOPe 2.01
  
• d2iuod1 appears in the current release, SCOPe 2.08