Class a: All alpha proteins [46456] (258 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) |
Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein) probably does not bind to DNA |
Protein Cyanase N-terminal domain [47436] (1 species) |
Species Escherichia coli [TaxId:562] [47437] (4 PDB entries) |
Domain d2iuoa1: 2iuo A:1-86 [137689] Other proteins in same PDB: d2iuoa2, d2iuob2, d2iuoc2, d2iuod2, d2iuoe2, d2iuof2, d2iuog2, d2iuoh2, d2iuoi2, d2iuoj2 automatically matched to d1dw9a1 complexed with azi, br, cl, so4; mutant |
PDB Entry: 2iuo (more details), 1.9 Å
SCOP Domain Sequences for d2iuoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iuoa1 a.35.1.4 (A:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]} miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl vgakldldedsilllqmiplrgcidd
Timeline for d2iuoa1: