SCOP 1.73: Domain d2iubi2: 2iub I:286-349

Lineage for d2iubi2 (2iub I:286-349)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family)
   forms homopentameric channel

5. Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein)
   C-terminal part of Pfam PF01544

6. Protein Magnesium transport protein CorA [144085] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries)

8. Domain d2iubi2: 2iub I:286-349 [137686]
   Other proteins in same PDB: d2iuba1, d2iubb1, d2iubc1, d2iubd1, d2iube1, d2iubf1, d2iubg1, d2iubh1, d2iubi1, d2iubj1
   automatically matched to 2BBJ A:286-349
   complexed with cl, mg

Details for d2iubi2

PDB Entry: 2iub, 2.9 Å

PDB Description: crystal structure of a divalent metal ion transporter cora at 2.9 a resolution.

PDB Compounds: (I:) divalent cation transport-related protein

SCOP Domain Sequences for d2iubi2:

Sequence, based on SEQRES records:

>d2iubi2 f.17.3.1 (I:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf
kkkk

Sequence, based on observed residues (ATOM records):

>d2iubi2 f.17.3.1 (I:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmympelrwkwgypvvlavmgviavimvvyfkkk
k

Timeline for d2iubi2:

• d2iubi2 is new in SCOP 1.73
  
• d2iubi2 appears in SCOP 1.75
  
• d2iubi2 appears in the current release, SCOPe 2.08