Lineage for d2iubi1 (2iub I:9-285)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741889Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
    beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel
  4. 741890Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) (S)
  5. 741891Family d.328.1.1: CorA soluble domain-like [143866] (1 protein)
    N-terminal part of Pfam PF01544
  6. 741892Protein Magnesium transport protein CorA, soluble domain [143867] (1 species)
  7. 741893Species Thermotoga maritima [TaxId:2336] [143868] (4 PDB entries)
  8. 741903Domain d2iubi1: 2iub I:9-285 [137685]
    Other proteins in same PDB: d2iuba2, d2iubb2, d2iubc2, d2iubd2, d2iube2, d2iubf2, d2iubg2, d2iubh2, d2iubi2, d2iubj2
    automatically matched to 2BBJ A:9-285
    complexed with cl, mg

Details for d2iubi1

PDB Entry: 2iub (more details), 2.9 Å

PDB Description: crystal structure of a divalent metal ion transporter cora at 2.9 a resolution.
PDB Compounds: (I:) divalent cation transport-related protein

SCOP Domain Sequences for d2iubi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iubi1 d.328.1.1 (I:9-285) Magnesium transport protein CorA, soluble domain {Thermotoga maritima [TaxId: 2336]}
kkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgih
rtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheleseqvs
liltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvlleki
ddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketv
pyfrdvydhtiqiadtvetfrdivsglldvylssvsn

SCOP Domain Coordinates for d2iubi1:

Click to download the PDB-style file with coordinates for d2iubi1.
(The format of our PDB-style files is described here.)

Timeline for d2iubi1: