SCOP 1.73: Domain d2iubh1: 2iub H:9-285

Lineage for d2iubh1 (2iub H:9-285)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
   beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel

4. Superfamily d.328.1: CorA soluble domain-like [143865] (1 family)

5. Family d.328.1.1: CorA soluble domain-like [143866] (1 protein)
   N-terminal part of Pfam PF01544

6. Protein Magnesium transport protein CorA, soluble domain [143867] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [143868] (4 PDB entries)

8. Domain d2iubh1: 2iub H:9-285 [137683]
   Other proteins in same PDB: d2iuba2, d2iubb2, d2iubc2, d2iubd2, d2iube2, d2iubf2, d2iubg2, d2iubh2, d2iubi2, d2iubj2
   automatically matched to 2BBJ A:9-285
   complexed with cl, mg

Details for d2iubh1

PDB Entry: 2iub, 2.9 Å

PDB Description: crystal structure of a divalent metal ion transporter cora at 2.9 a resolution.

PDB Compounds: (H:) divalent cation transport-related protein

SCOP Domain Sequences for d2iubh1:

Sequence; same for both SEQRES and ATOM records:

>d2iubh1 d.328.1.1 (H:9-285) Magnesium transport protein CorA, soluble domain {Thermotoga maritima [TaxId: 2336]}
kkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgih
rtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheleseqvs
liltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvlleki
ddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketv
pyfrdvydhtiqiadtvetfrdivsglldvylssvsn

Timeline for d2iubh1:

• d2iubh1 is new in SCOP 1.73
  
• d2iubh1 appears in SCOP 1.75
  
• d2iubh1 appears in the current release, SCOPe 2.08