Lineage for d2iubd1 (2iub D:5-285)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616869Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
    beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel
  4. 2616870Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) (S)
  5. 2616871Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins)
    N-terminal part of Pfam PF01544
  6. 2616885Protein automated matches [227110] (2 species)
    not a true protein
  7. 2616886Species Thermotoga maritima [TaxId:2336] [255245] (1 PDB entry)
  8. 2616890Domain d2iubd1: 2iub D:5-285 [137675]
    Other proteins in same PDB: d2iuba2, d2iubb2, d2iubc2, d2iubd2, d2iube2, d2iubf2, d2iubg2, d2iubh2, d2iubi2, d2iubj2
    automated match to d4i0uh1
    complexed with cl, mg

Details for d2iubd1

PDB Entry: 2iub (more details), 2.9 Å

PDB Description: crystal structure of a divalent metal ion transporter cora at 2.9 a resolution.
PDB Compounds: (D:) divalent cation transport-related protein

SCOPe Domain Sequences for d2iubd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iubd1 d.328.1.1 (D:5-285) automated matches {Thermotoga maritima [TaxId: 2336]}
rlsakkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwini
tgihrtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheles
eqvsliltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvl
lekiddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplie
ketvpyfrdvydhtiqiadtvetfrdivsglldvylssvsn

SCOPe Domain Coordinates for d2iubd1:

Click to download the PDB-style file with coordinates for d2iubd1.
(The format of our PDB-style files is described here.)

Timeline for d2iubd1: