Lineage for d2iubc2 (2iub C:286-349)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745255Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
    two antiparallel transmembrane helices
  4. 745328Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family) (S)
    forms homopentameric channel
  5. 745329Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein)
    C-terminal part of Pfam PF01544
  6. 745330Protein Magnesium transport protein CorA [144085] (1 species)
  7. 745331Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries)
  8. 745334Domain d2iubc2: 2iub C:286-349 [137674]
    Other proteins in same PDB: d2iuba1, d2iubb1, d2iubc1, d2iubd1, d2iube1, d2iubf1, d2iubg1, d2iubh1, d2iubi1, d2iubj1
    automatically matched to 2BBJ A:286-349
    complexed with cl, mg

Details for d2iubc2

PDB Entry: 2iub (more details), 2.9 Å

PDB Description: crystal structure of a divalent metal ion transporter cora at 2.9 a resolution.
PDB Compounds: (C:) divalent cation transport-related protein

SCOP Domain Sequences for d2iubc2:

Sequence, based on SEQRES records: (download)

>d2iubc2 f.17.3.1 (C:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf
kkkk

Sequence, based on observed residues (ATOM records): (download)

>d2iubc2 f.17.3.1 (C:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiyggypvvlavmgviavimvvyfkkkk

SCOP Domain Coordinates for d2iubc2:

Click to download the PDB-style file with coordinates for d2iubc2.
(The format of our PDB-style files is described here.)

Timeline for d2iubc2: