Lineage for d2iubb2 (2iub B:286-349)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629616Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family) (S)
    forms homopentameric channel
  5. 2629617Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein)
    C-terminal part of Pfam PF01544
  6. 2629618Protein Magnesium transport protein CorA [144085] (2 species)
  7. 2629619Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries)
    Uniprot Q9WZ31 286-349
  8. 2629621Domain d2iubb2: 2iub B:286-349 [137672]
    Other proteins in same PDB: d2iuba1, d2iubb1, d2iubc1, d2iubd1, d2iube1, d2iubf1, d2iubg1, d2iubh1, d2iubi1, d2iubj1
    complexed with cl, mg

Details for d2iubb2

PDB Entry: 2iub (more details), 2.9 Å

PDB Description: crystal structure of a divalent metal ion transporter cora at 2.9 a resolution.
PDB Compounds: (B:) divalent cation transport-related protein

SCOPe Domain Sequences for d2iubb2:

Sequence, based on SEQRES records: (download)

>d2iubb2 f.17.3.1 (B:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf
kkkk

Sequence, based on observed residues (ATOM records): (download)

>d2iubb2 f.17.3.1 (B:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygypvvlavmgviavimvvyfkkkk

SCOPe Domain Coordinates for d2iubb2:

Click to download the PDB-style file with coordinates for d2iubb2.
(The format of our PDB-style files is described here.)

Timeline for d2iubb2: