Lineage for d2iu7j2 (2iu7 J:87-156)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726733Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 726734Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) (S)
  5. 726735Family d.72.1.1: Cyanase C-terminal domain [55235] (1 protein)
    active form is a decamer formed by five dimers
  6. 726736Protein Cyanase C-terminal domain [55236] (1 species)
  7. 726737Species Escherichia coli [TaxId:562] [55237] (4 PDB entries)
  8. 726767Domain d2iu7j2: 2iu7 J:87-156 [137668]
    Other proteins in same PDB: d2iu7a1, d2iu7b1, d2iu7c1, d2iu7d1, d2iu7e1, d2iu7f1, d2iu7g1, d2iu7h1, d2iu7i1, d2iu7j1
    automatically matched to d1dw9a2
    complexed with oxl, so4; mutant

Details for d2iu7j2

PDB Entry: 2iu7 (more details), 1.91 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (J:) cyanate hydratase

SCOP Domain Sequences for d2iu7j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iu7j2 d.72.1.1 (J:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]}
riptdptmfrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOP Domain Coordinates for d2iu7j2:

Click to download the PDB-style file with coordinates for d2iu7j2.
(The format of our PDB-style files is described here.)

Timeline for d2iu7j2: