Class a: All alpha proteins [46456] (258 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) |
Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein) probably does not bind to DNA |
Protein Cyanase N-terminal domain [47436] (1 species) |
Species Escherichia coli [TaxId:562] [47437] (4 PDB entries) |
Domain d2iu7i1: 2iu7 I:1-86 [137665] Other proteins in same PDB: d2iu7a2, d2iu7b2, d2iu7c2, d2iu7d2, d2iu7e2, d2iu7f2, d2iu7g2, d2iu7h2, d2iu7i2, d2iu7j2 automatically matched to d1dw9a1 complexed with oxl, so4; mutant |
PDB Entry: 2iu7 (more details), 1.91 Å
SCOP Domain Sequences for d2iu7i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iu7i1 a.35.1.4 (I:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]} miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl vgakldldedsilllqmiplrgcidd
Timeline for d2iu7i1: