SCOP 1.75: Domain d2iu7h1: 2iu7 H:1-86

Lineage for d2iu7h1 (2iu7 H:1-86)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein)
   probably does not bind to DNA

6. Protein Cyanase N-terminal domain [47436] (1 species)

7. Species Escherichia coli [TaxId:562] [47437] (4 PDB entries)

8. Domain d2iu7h1: 2iu7 H:1-86 [137663]
   Other proteins in same PDB: d2iu7a2, d2iu7b2, d2iu7c2, d2iu7d2, d2iu7e2, d2iu7f2, d2iu7g2, d2iu7h2, d2iu7i2, d2iu7j2
   automatically matched to d1dw9a1
   complexed with oxl, so4; mutant

Details for d2iu7h1

PDB Entry: 2iu7, 1.91 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase

PDB Compounds: (H:) cyanate hydratase

SCOP Domain Sequences for d2iu7h1:

Sequence; same for both SEQRES and ATOM records:

>d2iu7h1 a.35.1.4 (H:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

Timeline for d2iu7h1:

• d2iu7h1 first appeared in SCOP 1.73
  
• d2iu7h1 appears in SCOPe 2.01
  
• d2iu7h1 appears in the current release, SCOPe 2.08