SCOPe 2.01: Domain d2iu7f2: 2iu7 F:87-156

Lineage for d2iu7f2 (2iu7 F:87-156)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family)

5. Family d.72.1.1: Cyanase C-terminal domain [55235] (1 protein)
   active form is a decamer formed by five dimers

6. Protein Cyanase C-terminal domain [55236] (1 species)

7. Species Escherichia coli [TaxId:562] [55237] (4 PDB entries)

8. Domain d2iu7f2: 2iu7 F:87-156 [137660]
   Other proteins in same PDB: d2iu7a1, d2iu7b1, d2iu7c1, d2iu7d1, d2iu7e1, d2iu7f1, d2iu7g1, d2iu7h1, d2iu7i1, d2iu7j1
   automatically matched to d1dw9a2
   complexed with oxl, so4

Details for d2iu7f2

PDB Entry: 2iu7, 1.91 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase

PDB Compounds: (F:) cyanate hydratase

SCOPe Domain Sequences for d2iu7f2:

Sequence; same for both SEQRES and ATOM records:

>d2iu7f2 d.72.1.1 (F:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]}
riptdptmfrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

Timeline for d2iu7f2:

• d2iu7f2 first appeared in SCOP 1.73
  
• d2iu7f2 appears in SCOP 1.75
  
• d2iu7f2 appears in SCOPe 2.02
  
• d2iu7f2 appears in the current release, SCOPe 2.08