Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily) intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta |
Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) |
Family d.72.1.1: Cyanase C-terminal domain [55235] (1 protein) active form is a decamer formed by five dimers |
Protein Cyanase C-terminal domain [55236] (1 species) |
Species Escherichia coli [TaxId:562] [55237] (4 PDB entries) |
Domain d2iu7e2: 2iu7 E:87-156 [137658] Other proteins in same PDB: d2iu7a1, d2iu7b1, d2iu7c1, d2iu7d1, d2iu7e1, d2iu7f1, d2iu7g1, d2iu7h1, d2iu7i1, d2iu7j1 automatically matched to d1dw9a2 complexed with oxl, so4; mutant |
PDB Entry: 2iu7 (more details), 1.91 Å
SCOP Domain Sequences for d2iu7e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iu7e2 d.72.1.1 (E:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]} riptdptmfrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl dgkylptkpf
Timeline for d2iu7e2: