Lineage for d2iu7b1 (2iu7 B:1-86)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768141Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein)
    probably does not bind to DNA
  6. 768142Protein Cyanase N-terminal domain [47436] (1 species)
  7. 768143Species Escherichia coli [TaxId:562] [47437] (4 PDB entries)
  8. 768165Domain d2iu7b1: 2iu7 B:1-86 [137651]
    Other proteins in same PDB: d2iu7a2, d2iu7b2, d2iu7c2, d2iu7d2, d2iu7e2, d2iu7f2, d2iu7g2, d2iu7h2, d2iu7i2, d2iu7j2
    automatically matched to d1dw9a1
    complexed with oxl, so4; mutant

Details for d2iu7b1

PDB Entry: 2iu7 (more details), 1.91 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
PDB Compounds: (B:) cyanate hydratase

SCOP Domain Sequences for d2iu7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iu7b1 a.35.1.4 (B:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

SCOP Domain Coordinates for d2iu7b1:

Click to download the PDB-style file with coordinates for d2iu7b1.
(The format of our PDB-style files is described here.)

Timeline for d2iu7b1: