SCOPe 2.05: Domain d2itlb_: 2itl B:

Lineage for d2itlb_ (2itl B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)

6. Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)

7. Species Simian virus 40, Sv40 [TaxId:10633] [55467] (11 PDB entries)

8. Domain d2itlb_: 2itl B: [137645]
   automated match to d1tbd__
   protein/DNA complex

Details for d2itlb_

PDB Entry: 2itl, 1.65 Å

PDB Description: the origin binding domain of the sv40 large t antigen bound to the functional pen palindrome dna (23 bp)

PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d2itlb_:

Sequence; same for both SEQRES and ATOM records:

>d2itlb_ d.89.1.1 (B:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
pkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynhni
lffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslp

Timeline for d2itlb_:

• d2itlb_ first appeared in SCOP 1.73, called d2itlb1
  
• d2itlb_ appears in SCOPe 2.04
  
• d2itlb_ appears in SCOPe 2.06
  
• d2itlb_ appears in the current release, SCOPe 2.08