SCOP 1.75: Domain d2itlb1: 2itl B:135-249

Lineage for d2itlb1 (2itl B:135-249)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families)

5. Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (1 protein)

6. Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)

7. Species Simian virus 40, Sv40 [TaxId:10633] [55467] (9 PDB entries)

8. Domain d2itlb1: 2itl B:135-249 [137645]
   automatically matched to d1tbd__

Details for d2itlb1

PDB Entry: 2itl, 1.65 Å

PDB Description: the origin binding domain of the sv40 large t antigen bound to the functional pen palindrome dna (23 bp)

PDB Compounds: (B:) large t antigen

SCOP Domain Sequences for d2itlb1:

Sequence; same for both SEQRES and ATOM records:

>d2itlb1 d.89.1.1 (B:135-249) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
pkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynhni
lffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslp

Timeline for d2itlb1:

• d2itlb1 first appeared in SCOP 1.73
  
• d2itlb1 is called d2itlb_ in SCOPe 2.01
  
• d2itlb1 appears in the current release, SCOPe 2.08, called d2itlb_