Lineage for d2itlb_ (2itl B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528607Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2528608Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2528609Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 2528610Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. 2528617Species Simian virus 40, Sv40 [TaxId:10633] [55467] (10 PDB entries)
  8. 2528623Domain d2itlb_: 2itl B: [137645]
    automated match to d1tbd__
    protein/DNA complex

Details for d2itlb_

PDB Entry: 2itl (more details), 1.65 Å

PDB Description: the origin binding domain of the sv40 large t antigen bound to the functional pen palindrome dna (23 bp)
PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d2itlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itlb_ d.89.1.1 (B:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
pkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynhni
lffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslp

SCOPe Domain Coordinates for d2itlb_:

Click to download the PDB-style file with coordinates for d2itlb_.
(The format of our PDB-style files is described here.)

Timeline for d2itlb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2itla_