Class b: All beta proteins [48724] (178 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.1: WW domain [51045] (2 families) |
Family b.72.1.1: WW domain [51046] (13 proteins) |
Protein Mitotic rotamase PIN1 [51047] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [51048] (40 PDB entries) |
Domain d2itka1: 2itk A:7-38 [137642] Other proteins in same PDB: d2itka2 complexed with pe4 |
PDB Entry: 2itk (more details), 1.45 Å
SCOPe Domain Sequences for d2itka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2itka1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} lppgwekamsrssgrvyyfnhitnasqwerps
Timeline for d2itka1: