SCOPe 2.05: Domain d2itka1: 2itk A:7-38

Lineage for d2itka1 (2itk A:7-38)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein Mitotic rotamase PIN1 [51047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51048] (37 PDB entries)

8. Domain d2itka1: 2itk A:7-38 [137642]
   Other proteins in same PDB: d2itka2
   complexed with pe4

Details for d2itka1

PDB Entry: 2itk, 1.45 Å

PDB Description: human Pin1 bound to D-PEPTIDE

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2itka1:

Sequence; same for both SEQRES and ATOM records:

>d2itka1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
lppgwekamsrssgrvyyfnhitnasqwerps

Timeline for d2itka1:

• d2itka1 first appeared in SCOP 1.73
  
• d2itka1 appears in SCOPe 2.04
  
• d2itka1 appears in SCOPe 2.06
  
• d2itka1 appears in the current release, SCOPe 2.08