Lineage for d2itka1 (2itk A:7-38)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811242Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2811243Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2811244Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2811278Protein Mitotic rotamase PIN1 [51047] (1 species)
  7. 2811279Species Human (Homo sapiens) [TaxId:9606] [51048] (40 PDB entries)
  8. 2811280Domain d2itka1: 2itk A:7-38 [137642]
    Other proteins in same PDB: d2itka2
    complexed with pe4

Details for d2itka1

PDB Entry: 2itk (more details), 1.45 Å

PDB Description: human Pin1 bound to D-PEPTIDE
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2itka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itka1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
lppgwekamsrssgrvyyfnhitnasqwerps

SCOPe Domain Coordinates for d2itka1:

Click to download the PDB-style file with coordinates for d2itka1.
(The format of our PDB-style files is described here.)

Timeline for d2itka1: