Lineage for d2itjb_ (2itj B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660345Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 1660346Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 1660347Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 1660348Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. 1660354Species Simian virus 40, Sv40 [TaxId:10633] [55467] (11 PDB entries)
  8. 1660365Domain d2itjb_: 2itj B: [137641]
    automated match to d1tbd__

Details for d2itjb_

PDB Entry: 2itj (more details), 2.5 Å

PDB Description: Origin binding domain of the SV40 large T antigen (residues 131-259). P212121 crystal form
PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d2itjb_:

Sequence, based on SEQRES records: (download)

>d2itjb_ d.89.1.1 (B:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
vedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsyn
hnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpgg
l

Sequence, based on observed residues (ATOM records): (download)

>d2itjb_ d.89.1.1 (B:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
vedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsyn
hnilffltphrhrvsainnyaqkfsflickgvnkeylmysaltrdpfsvieeslpggl

SCOPe Domain Coordinates for d2itjb_:

Click to download the PDB-style file with coordinates for d2itjb_.
(The format of our PDB-style files is described here.)

Timeline for d2itjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2itja_