Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (2 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries) |
Domain d2itdc_: 2itd C: [137639] Other proteins in same PDB: d2itda1, d2itda2, d2itdb1, d2itdb2 automated match to d1r3jc_ complexed with ba |
PDB Entry: 2itd (more details), 2.7 Å
SCOPe Domain Sequences for d2itdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2itdc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2itdc_:
View in 3D Domains from other chains: (mouse over for more information) d2itda1, d2itda2, d2itdb1, d2itdb2 |