Lineage for d2itdc_ (2itd C:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456013Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1456014Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1456015Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1456036Protein Potassium channel protein [56901] (2 species)
  7. 1456079Species Streptomyces lividans [TaxId:1916] [161074] (17 PDB entries)
  8. 1456090Domain d2itdc_: 2itd C: [137639]
    Other proteins in same PDB: d2itda1, d2itda2, d2itdb1, d2itdb2
    automated match to d1r3jc_
    complexed with ba

Details for d2itdc_

PDB Entry: 2itd (more details), 2.7 Å

PDB Description: potassium channel kcsa-fab complex in barium chloride
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2itdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itdc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2itdc_:

Click to download the PDB-style file with coordinates for d2itdc_.
(The format of our PDB-style files is described here.)

Timeline for d2itdc_: