SCOPe 2.02: Domain d2itdc1: 2itd C:22-124

Lineage for d2itdc1 (2itd C:22-124)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (12 PDB entries)

8. Domain d2itdc1: 2itd C:22-124 [137639]
   automatically matched to d1k4cc_
   complexed with ba

Details for d2itdc1

PDB Entry: 2itd, 2.7 Å

PDB Description: potassium channel kcsa-fab complex in barium chloride

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2itdc1:

Sequence; same for both SEQRES and ATOM records:

>d2itdc1 f.14.1.1 (C:22-124) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2itdc1:

• d2itdc1 first appeared in SCOP 1.73
  
• d2itdc1 appears in SCOPe 2.01
  
• d2itdc1 is called d2itdc_ in SCOPe 2.03
  
• d2itdc1 appears in the current release, SCOPe 2.08, called d2itdc_