Lineage for d2itcc1 (2itc C:22-124)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252691Protein Potassium channel protein [56901] (2 species)
  7. 2252736Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries)
  8. 2252754Domain d2itcc1: 2itc C:22-124 [137638]
    automatically matched to d1k4cc_
    complexed with na

Details for d2itcc1

PDB Entry: 2itc (more details), 3.2 Å

PDB Description: potassium channel kcsa-fab complex in sodium chloride
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2itcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itcc1 f.14.1.1 (C:22-124) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2itcc1:

Click to download the PDB-style file with coordinates for d2itcc1.
(The format of our PDB-style files is described here.)

Timeline for d2itcc1: