SCOP 1.75: Domain d2it9d1: 2it9 D:1-122

Lineage for d2it9d1 (2it9 D:1-122)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (4 families)

5. Family d.18.1.3: PMN2A0962/syc2379c-like [143038] (2 proteins)
   Pfam PF08848; DUF1818; specific to cyanobacteria; single-chain domain made of two repeats of this structural motif

6. Protein Hypothetical protein PMN2A_0962 [143039] (1 species)

7. Species Prochlorococcus marinus [TaxId:1219] [143040] (1 PDB entry)
   Uniprot Q46J75 1-122

8. Domain d2it9d1: 2it9 D:1-122 [137637]
   automatically matched to 2IT9 A:1-122
   complexed with cl, edo, pge, trs

Details for d2it9d1

PDB Entry: 2it9, 1.8 Å

PDB Description: crystal structure of a protein with unknown function from duf155 family (yp_292156.1) from prochlorococcus sp. natl2a at 1.80 a resolution

PDB Compounds: (D:) hypothetical protein

SCOP Domain Sequences for d2it9d1:

Sequence; same for both SEQRES and ATOM records:

>d2it9d1 d.18.1.3 (D:1-122) Hypothetical protein PMN2A_0962 {Prochlorococcus marinus [TaxId: 1219]}
mikkegpgwriifdssrdnfstliggetwaieldksewkilvevvmelcdqyklvkeqlm
gdeditlelerrpwlailngdqygwnlrlilsasglfnrgaevywprhvtnnvvnamrsm
wd

Timeline for d2it9d1:

• d2it9d1 first appeared in SCOP 1.73
  
• d2it9d1 is called d2it9d_ in SCOPe 2.01
  
• d2it9d1 appears in the current release, SCOPe 2.08, called d2it9d_