Lineage for d2it9c_ (2it9 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937473Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 2937474Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 2937504Family d.18.1.3: PMN2A0962/syc2379c-like [143038] (2 proteins)
    Pfam PF08848; DUF1818; specific to cyanobacteria; single-chain domain made of two repeats of this structural motif
  6. 2937505Protein Hypothetical protein PMN2A_0962 [143039] (1 species)
  7. 2937506Species Prochlorococcus marinus [TaxId:1219] [143040] (1 PDB entry)
    Uniprot Q46J75 1-122
  8. 2937509Domain d2it9c_: 2it9 C: [137636]
    Other proteins in same PDB: d2it9a2
    automated match to d2it9a1
    complexed with cl, edo, pge, trs

Details for d2it9c_

PDB Entry: 2it9 (more details), 1.8 Å

PDB Description: crystal structure of a protein with unknown function from duf155 family (yp_292156.1) from prochlorococcus sp. natl2a at 1.80 a resolution
PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2it9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2it9c_ d.18.1.3 (C:) Hypothetical protein PMN2A_0962 {Prochlorococcus marinus [TaxId: 1219]}
mikkegpgwriifdssrdnfstliggetwaieldksewkilvevvmelcdqyklvkeqlm
gdeditlelerrpwlailngdqygwnlrlilsasglfnrgaevywprhvtnnvvnamrsm

SCOPe Domain Coordinates for d2it9c_:

Click to download the PDB-style file with coordinates for d2it9c_.
(The format of our PDB-style files is described here.)

Timeline for d2it9c_: