SCOP 1.73: Domain d2it9b1: 2it9 B:1-120

Lineage for d2it9b1 (2it9 B:1-120)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (4 families)

5. Family d.18.1.3: PMN2A0962/syc2379c-like [143038] (2 proteins)
   Pfam PF08848; DUF1818; specific to cyanobacteria; single-chain domain made of two repeats of this structural motif

6. Protein Hypothetical protein PMN2A_0962 [143039] (1 species)

7. Species Prochlorococcus marinus [TaxId:1219] [143040] (1 PDB entry)

8. Domain d2it9b1: 2it9 B:1-120 [137635]
   automatically matched to 2IT9 A:1-122
   complexed with cl, edo, pge, trs

Details for d2it9b1

PDB Entry: 2it9, 1.8 Å

PDB Description: crystal structure of a protein with unknown function from duf155 family (yp_292156.1) from prochlorococcus sp. natl2a at 1.80 a resolution

PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2it9b1:

Sequence; same for both SEQRES and ATOM records:

>d2it9b1 d.18.1.3 (B:1-120) Hypothetical protein PMN2A_0962 {Prochlorococcus marinus [TaxId: 1219]}
mikkegpgwriifdssrdnfstliggetwaieldksewkilvevvmelcdqyklvkeqlm
gdeditlelerrpwlailngdqygwnlrlilsasglfnrgaevywprhvtnnvvnamrsm

Timeline for d2it9b1:

• d2it9b1 is new in SCOP 1.73
  
• d2it9b1 appears in SCOP 1.75
  
• d2it9b1 appears in the current release, SCOPe 2.08, called d2it9b_