Lineage for d2it5a1 (2it5 A:253-384)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 737909Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)
  7. 737910Species Human (Homo sapiens) [TaxId:9606] [69856] (6 PDB entries)
  8. 737914Domain d2it5a1: 2it5 A:253-384 [137632]
    automatically matched to d1k9id_
    complexed with ca, man

Details for d2it5a1

PDB Entry: 2it5 (more details), 2.4 Å

PDB Description: crystal structure of dcsign-crd with man6
PDB Compounds: (A:) CD209 antigen, DCSIGN-CRD

SCOP Domain Sequences for d2it5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2it5a1 d.169.1.1 (A:253-384) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens) [TaxId: 9606]}
chpcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnr
ftwmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnla
kfwickksaasc

SCOP Domain Coordinates for d2it5a1:

Click to download the PDB-style file with coordinates for d2it5a1.
(The format of our PDB-style files is described here.)

Timeline for d2it5a1: