![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
![]() | Protein Iron-dependent regulator [47983] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries) Uniprot Q50495 |
![]() | Domain d2it0d2: 2it0 D:65-139 [137631] Other proteins in same PDB: d2it0a1, d2it0a3, d2it0b1, d2it0b3, d2it0c1, d2it0d1 automated match to d1b1ba2 protein/DNA complex; complexed with act, ni |
PDB Entry: 2it0 (more details), 2.6 Å
SCOPe Domain Sequences for d2it0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2it0d2 a.76.1.1 (D:65-139) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]} tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt tspfgnpipglvelg
Timeline for d2it0d2: