Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) contains a small beta-sheet (wing) |
Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins) |
Protein Iron-dependent regulator IdeR [46885] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries) |
Domain d2it0b1: 2it0 B:3-64 [137626] Other proteins in same PDB: d2it0a2, d2it0b2, d2it0c2, d2it0d2 automatically matched to d1b1ba1 complexed with act, ni |
PDB Entry: 2it0 (more details), 2.6 Å
SCOP Domain Sequences for d2it0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2it0b1 a.4.5.24 (B:3-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} elvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdrhl el
Timeline for d2it0b1: