Lineage for d2it0b1 (2it0 B:3-64)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635328Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)
  6. 635361Protein Iron-dependent regulator IdeR [46885] (1 species)
  7. 635362Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries)
  8. 635374Domain d2it0b1: 2it0 B:3-64 [137626]
    Other proteins in same PDB: d2it0a2, d2it0b2, d2it0c2, d2it0d2
    automatically matched to d1b1ba1
    complexed with act, ni

Details for d2it0b1

PDB Entry: 2it0 (more details), 2.6 Å

PDB Description: Crystal structure of a two-domain IdeR-DNA complex crystal form II
PDB Compounds: (B:) iron-dependent repressor ider

SCOP Domain Sequences for d2it0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2it0b1 a.4.5.24 (B:3-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
elvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdrhl
el

SCOP Domain Coordinates for d2it0b1:

Click to download the PDB-style file with coordinates for d2it0b1.
(The format of our PDB-style files is described here.)

Timeline for d2it0b1: