SCOPe 2.08: Domain d2it0a2: 2it0 A:65-140

Lineage for d2it0a2 (2it0 A:65-140)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Iron-dependent regulator [47983] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
   Uniprot Q50495

8. Domain d2it0a2: 2it0 A:65-140 [137625]
   Other proteins in same PDB: d2it0a1, d2it0a3, d2it0b1, d2it0b3, d2it0c1, d2it0d1
   automated match to d2iszd2
   protein/DNA complex; complexed with act, ni

Details for d2it0a2

PDB Entry: 2it0, 2.6 Å

PDB Description: Crystal structure of a two-domain IdeR-DNA complex crystal form II

PDB Compounds: (A:) iron-dependent repressor ider

SCOPe Domain Sequences for d2it0a2:

Sequence; same for both SEQRES and ATOM records:

>d2it0a2 a.76.1.1 (A:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgv

Timeline for d2it0a2:

• d2it0a2 first appeared in SCOP 1.73
  
• d2it0a2 appears in SCOPe 2.07