SCOPe 2.07: Domain d2iszd2: 2isz D:65-140

Lineage for d2iszd2 (2isz D:65-140)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Iron-dependent regulator [47983] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
   Uniprot Q50495

8. Domain d2iszd2: 2isz D:65-140 [137623]
   Other proteins in same PDB: d2isza1, d2iszb1, d2iszc1, d2iszd1
   automated match to d2iszd2
   protein/DNA complex; complexed with na, ni

Details for d2iszd2

PDB Entry: 2isz, 2.4 Å

PDB Description: crystal structure of a two-domain ider-dna complex crystal form i

PDB Compounds: (D:) iron-dependent repressor ider

SCOPe Domain Sequences for d2iszd2:

Sequence; same for both SEQRES and ATOM records:

>d2iszd2 a.76.1.1 (D:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgv

Timeline for d2iszd2:

• d2iszd2 first appeared in SCOP 1.73
  
• d2iszd2 appears in SCOPe 2.06
  
• d2iszd2 appears in the current release, SCOPe 2.08