SCOP 1.75: Domain d2iszd1: 2isz D:2-64

Lineage for d2iszd1 (2isz D:2-64)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)

6. Protein Iron-dependent regulator IdeR [46885] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries)
   Uniprot Q50495

8. Domain d2iszd1: 2isz D:2-64 [137622]
   Other proteins in same PDB: d2isza2, d2iszb2, d2iszc2, d2iszd2
   automatically matched to d1b1ba1
   complexed with na, ni

Details for d2iszd1

PDB Entry: 2isz, 2.4 Å

PDB Description: crystal structure of a two-domain ider-dna complex crystal form i

PDB Compounds: (D:) iron-dependent repressor ider

SCOP Domain Sequences for d2iszd1:

Sequence; same for both SEQRES and ATOM records:

>d2iszd1 a.4.5.24 (D:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
nelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdrh
lel

Timeline for d2iszd1:

• d2iszd1 first appeared in SCOP 1.73
  
• d2iszd1 appears in SCOPe 2.01
  
• d2iszd1 appears in the current release, SCOPe 2.08