SCOP 1.73: Domain d2iszc2: 2isz C:65-140

Lineage for d2iszc2 (2isz C:65-140)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Iron-dependent regulator [47983] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)

8. Domain d2iszc2: 2isz C:65-140 [137621]
   Other proteins in same PDB: d2isza1, d2iszb1, d2iszc1, d2iszd1
   automatically matched to d1b1ba2
   complexed with na, ni

Details for d2iszc2

PDB Entry: 2isz, 2.4 Å

PDB Description: crystal structure of a two-domain ider-dna complex crystal form i

PDB Compounds: (C:) iron-dependent repressor ider

SCOP Domain Sequences for d2iszc2:

Sequence; same for both SEQRES and ATOM records:

>d2iszc2 a.76.1.1 (C:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgv

Timeline for d2iszc2:

• d2iszc2 is new in SCOP 1.73
  
• d2iszc2 appears in SCOP 1.75
  
• d2iszc2 appears in the current release, SCOPe 2.08